PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01258.1.g00140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 430aa    MW: 47420.2 Da    PI: 9.4719
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01258.1.g00140.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding482.8e-15104151148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g+WT eEd  l++ v+  G g+W+  ar  g++Rt+k+c++rw++yl
  Zmw_sc01258.1.g00140.1.am.mk 104 KGPWTVEEDAVLAHHVAANGEGRWNELARAAGLRRTGKSCRLRWLNYL 151
                                   79********************************************97 PP

2Myb_DNA-binding42.71.3e-13157200146
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                   rg + + E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Zmw_sc01258.1.g00140.1.am.mk 157 RGDFAPREQLLILELHFRWGNR-WSRIAAHLP-GRTDNEVKNYWRT 200
                                   6778899***************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.57899155IPR017930Myb domain
SuperFamilySSF466892.7E-28102198IPR009057Homeodomain-like
SMARTSM007177.3E-13103153IPR001005SANT/Myb domain
PfamPF002491.3E-13104151IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-19105158IPR009057Homeodomain-like
CDDcd001672.74E-9106151No hitNo description
PROSITE profilePS5129415.36156206IPR017930Myb domain
SMARTSM007172.2E-12156204IPR001005SANT/Myb domain
PfamPF002499.2E-13157200IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-21159204IPR009057Homeodomain-like
CDDcd001672.26E-9162200No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 430 aa     Download sequence    Send to blast
MRRPKKRPKK LTNLSSSVRA ALEKGGRRRL VVATASSSSS LNSSPTRFFC PASYAHSSLQ  60
LAEVSDPSRS MDALWMGACE WSSAAASATS IEDEEAAAAA ELRKGPWTVE EDAVLAHHVA  120
ANGEGRWNEL ARAAGLRRTG KSCRLRWLNY LRPGVRRGDF APREQLLILE LHFRWGNRWS  180
RIAAHLPGRT DNEVKNYWRT RVQKHARQLG CDIGSRRFRD VMRQHWMPRL VERIQADSGA  240
AVSQSQPATT ASKQPSYHYI ASNNCGSHAK PCASPDASCV TAGPSSPESS HEAQFQTNSP  300
IMDAAGAGYS SSTEQCQYGS GSGDMLDGSW SELLARASPG NADSTGLHDF EFGEIHTAVL  360
NRSQKKKPTR FSMTWSMVNY WSSVVNGLRS MLDPGRLCLE SNGCDELDRR LCEIRSWVPN  420
FASIFLTLAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-2310120424126MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
119RRPKKRPKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001152038.11e-101cpm7
TrEMBLD8L9I21e-104D8L9I2_WHEAT; Myb-like DNA-binding domain containing protein,expressed
STRINGGRMZM2G158700_P011e-100(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330